224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Interleukin-3 |
|---|
Gene and Protein Information
| Gene ID | 3562 |
|---|---|
| Uniprot Accession IDs | P08700 Q6GS87 IL-3 |
| Ensembl ID | ENSP00000296870 |
| Symbol | IL-3 MCGF MULTI-CSF |
| Family | Belongs to the IL-3 family. |
| Sequence | MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 471626 | IL3 | interleukin 3 | 9598 | VGNC:4044 | Inparanoid, OMA, EggNOG |
| Macaque | 706946 | IL3 | interleukin 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Dog | 481497 | IL3 | interleukin 3 | 9615 | VGNC:53502 | Inparanoid, OMA |
| Cow | 280823 | IL3 | interleukin 3 (colony-stimulating factor, multiple) | 9913 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.