224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Homeobox protein Meis3 |
|---|
Gene and Protein Information
| Gene ID | 56917 |
|---|---|
| Uniprot Accession IDs | Q99687 A8K1N5 Q6NT73 Q8TC66 Q9NPW2 |
| Ensembl ID | ENSP00000453307 |
| Symbol | MRG2 MRG2 |
| Family | Belongs to the TALE/MEIS homeobox family. |
| Sequence | MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746106 | MEIS3 | Meis homeobox 3 | 9598 | VGNC:13326 | Inparanoid, OMA, EggNOG |
| Mouse | 17537 | Meis3 | Meis homeobox 3 | 10090 | MGI:108519 | Inparanoid, OMA, EggNOG |
| Rat | 361514 | Meis3 | Meis homeobox 3 | 10116 | RGD:1308532 | Inparanoid, OMA, EggNOG |
| Dog | 484421 | MEIS3 | Meis homeobox 3 | 9615 | VGNC:53737 | Inparanoid, OMA, EggNOG |
| Horse | 100066050 | MEIS3 | Meis homeobox 3 | 9796 | VGNC:51054 | Inparanoid, OMA, EggNOG |
| Cow | 617311 | MEIS3 | Meis homeobox 3 | 9913 | VGNC:52205 | OMA, EggNOG |
| Pig | 100518492 | MEIS3 | Meis homeobox 3 | 9823 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / RNA binding protein / homeodomain transcription factor / Homeobox protein Meis3
protein / RNA binding protein / DNA-directed RNA polymerase / Homeobox protein Meis3
protein / RNA binding protein / homeodomain transcription factor / Homeobox protein Meis3
protein / RNA binding protein / DNA-directed RNA polymerase / Homeobox protein Meis3
DTO Classes
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / Homeobox protein Meis3
protein / Enzyme / Transferase / Nucleotidyltransferase / Polymerase / DNA-directed RNA polymerase / Homeobox protein Meis3
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.