🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

KLK14

DescripciónKallikrein-14

Gene and Protein Information

Gene ID43847
Uniprot Accession IDs Q9P0G3 A7UNK5 Q1RMZ2 Q6B089 hK14
Ensembl ID ENSP00000375678
Symbol KLKL6 KLK-L6
FamilyBelongs to the peptidase S1 family. Kallikrein subfamily.
Sequence
MSLRVLGSGTWPSAPKMFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQWVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKYRSWIEETMRDK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse317653Klk14kallikrein related-peptidase 1410090MGI:2447564Inparanoid, OMA, EggNOG
Rat308562Klk14kallikrein related-peptidase 1410116RGD:1308606Inparanoid, OMA, EggNOG
Dog484348KLK14kallikrein related peptidase 149615VGNC:42481Inparanoid, OMA, EggNOG
Horse100067040KLK14kallikrein related peptidase 149796VGNC:19486Inparanoid, OMA, EggNOG
Cow613993KLK14kallikrein related peptidase 149913VGNC:30676Inparanoid, OMA, EggNOG
Opossum100028200KLK14kallikrein related peptidase 1413616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.