224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Mitochondrial 2-oxodicarboxylate carrier |
|---|
Gene and Protein Information
| Gene ID | 89874 |
|---|---|
| Uniprot Accession IDs | Q9BQT8 A8K0L0 G3V4L5 Q3MJ99 |
| Ensembl ID | ENSP00000329452 |
| Symbol | ODC ODC ODC1 |
| Family | Belongs to the mitochondrial carrier (TC 2.A.29) family. |
| Sequence | MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467433 | SLC25A21 | solute carrier family 25 member 21 | 9598 | VGNC:12533 | OMA, EggNOG |
| Macaque | 697370 | SLC25A21 | solute carrier family 25 member 21 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 217593 | Slc25a21 | solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 | 10090 | MGI:2445059 | Inparanoid, OMA, EggNOG |
| Rat | 171151 | Slc25a21 | solute carrier family 25 member 21 | 10116 | RGD:621444 | Inparanoid, OMA, EggNOG |
| Dog | 490655 | SLC25A21 | solute carrier family 25 member 21 | 9615 | VGNC:46300 | Inparanoid, OMA, EggNOG |
| Horse | 100059414 | SLC25A21 | solute carrier family 25 member 21 | 9796 | VGNC:23097 | Inparanoid, OMA, EggNOG |
| Cow | 513423 | SLC25A21 | solute carrier family 25 member 21 | 9913 | VGNC:34749 | Inparanoid, OMA, EggNOG |
| Pig | 100156821 | PAX9 | paired box 9 | 9823 | OMA, EggNOG | |
| Opossum | 100012583 | SLC25A21 | solute carrier family 25 member 21 | 13616 | Inparanoid, EggNOG | |
| Platypus | SLC25A21 | solute carrier family 25 member 21 [Source:HGNC Symbol;Acc:HGNC:14411] | 9258 | OMA, EggNOG | ||
| Chicken | 423330 | SLC25A21 | solute carrier family 25 member 21 | 9031 | CGNC:7688 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557800 | slc25a21 | solute carrier family 25 member 21 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 549823 | slc25a21 | solute carrier family 25 (mitochondrial oxoadipate carrier), member 21 | 8364 | XB-GENE-943812 | Inparanoid, OMA, EggNOG |
| Zebrafish | 767694 | slc25a21 | solute carrier family 25 (mitochondrial oxoadipate carrier), member 21 | 7955 | ZDB-GENE-060929-664 | Inparanoid, OMA, EggNOG |
| C. elegans | 181692 | slc-25A21 | SLC (SoLute Carrier) homolog | 6239 | OMA, EggNOG | |
| S.cerevisiae | 855969 | ODC1 | mitochondrial 2-oxodicarboxylate carrier | 4932 | S000006055 | Inparanoid, OMA, EggNOG |
Protein Classes
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial di- and tri-carboxylic acid transporter subfamily / Mitochondrial 2-oxodicarboxylate carrier
protein / Transporter / SLC superfamily of solute carriers / SLC25 family of mitochondrial transporters / Mitochondrial di- and tri-carboxylic acid transporter subfamily / Mitochondrial 2-oxodicarboxylate carrier
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.