🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CSNK2A2

DescripciónCasein kinase II subunit alpha'

Gene and Protein Information

Gene ID1459
Uniprot Accession IDs P19784 CK II alpha'
Ensembl ID ENSP00000262506
Symbol CK2A2 CK2A2 CSNK2A1 CK2alpha'
FamilyBelongs to the protein kinase superfamily. Ser/Thr protein kinase family. CK2 subfamily.
Sequence
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp454131CSNK2A2casein kinase 2 alpha 29598VGNC:8976OMA, EggNOG
Macaque712455CSNK2A2casein kinase 2 alpha 29544OMA, EggNOG
Mouse13000Csnk2a2casein kinase 2, alpha prime polypeptide10090MGI:88547OMA, EggNOG
Rat307641Csnk2a2casein kinase 2 alpha 210116RGD:1306882OMA, EggNOG
Dog478108CSNK2A2casein kinase 2 alpha 29615VGNC:39670OMA, EggNOG
Horse100063080CSNK2A2casein kinase 2 alpha 29796VGNC:16909OMA, EggNOG
Pig100737256CSNK2A2casein kinase 2 alpha 29823OMA, EggNOG
Platypus100074583CSNK2A2casein kinase 2 alpha 29258OMA, EggNOG
Anole lizard100566912csnk2a2casein kinase 2 alpha 228377OMA, EggNOG
C. elegans172978kin-3Casein kinase II subunit alpha6239OMA, EggNOG
S.cerevisiae854776CKA1casein kinase 2 catalytic subunit CKA14932S000001297OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    CMGC group    /    CK2 family    /    Casein kinase II subunit alpha'

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.