🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

MPC1

DescripciónMitochondrial pyruvate carrier 1

Gene and Protein Information

Gene ID51660
Uniprot Accession IDs Q9Y5U8 B2R5I7 Q5TI66 Q9HB67 Q9UQN4
Ensembl ID ENSP00000354223
Symbol BRP44L MPYCD BRP44L CGI-129 SLC54A1
FamilyBelongs to the mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family.
Sequence
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737234MPC1mitochondrial pyruvate carrier 19598VGNC:3488OMA, EggNOG
Macaque716864MPC1mitochondrial pyruvate carrier 19544OMA, EggNOG
Mouse55951Mpc1mitochondrial pyruvate carrier 110090MGI:1915240Inparanoid, OMA, EggNOG
Rat171087Mpc1mitochondrial pyruvate carrier 110116RGD:620902Inparanoid, OMA, EggNOG
HorseMPC1mitochondrial pyruvate carrier 1 [Source:HGNC Symbol;Acc:HGNC:21606]9796OMA, EggNOG
Cow767977MPC1mitochondrial pyruvate carrier 19913VGNC:31569Inparanoid, OMA, EggNOG
OpossumMPC1mitochondrial pyruvate carrier 1 [Source:HGNC Symbol;Acc:HGNC:21606]13616Inparanoid, OMA, EggNOG
Platypus100074647MPC1mitochondrial pyruvate carrier 19258Inparanoid, OMA, EggNOG
Chicken428592MPC1mitochondrial pyruvate carrier 19031CGNC:8725OMA, EggNOG
Anole lizard100553357mpc1mitochondrial pyruvate carrier 128377Inparanoid, OMA, EggNOG
Xenopus448739mpc1mitochondrial pyruvate carrier 18364XB-GENE-970069OMA, EggNOG
Zebrafish436671mpc1mitochondrial pyruvate carrier 17955ZDB-GENE-040718-94Inparanoid, OMA, EggNOG
Fruitfly42268Mpc1Mitochondrial pyruvate carrier7227FBgn0038662Inparanoid, EggNOG
S.cerevisiae852800MPC1pyruvate transporter MPC14932S000003048OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Transporter    /    SLC superfamily of solute carriers    /    SLC54 Mitochondrial pyruvate carriers    /    Mitochondrial pyruvate carrier 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.