MTF2

DescripciónMetal-response element-binding transcription factor 2

Gene and Protein Information

Gene ID22823
Uniprot Accession IDs Q9Y483 A6NGQ9 A8K2Q3 B1AKT5 B1AKT6 Q96G26 Q9UES9 Q9UP40
Ensembl ID ENSP00000359321
Symbol PCL2 M96 PCL2 TDRD19A dJ976O13.2
FamilyBelongs to the Polycomblike family.
Sequence
MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIKGRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp457026MTF2metal response element binding transcription factor 29598VGNC:1336OMA, EggNOG
Macaque707104MTF2metal response element binding transcription factor 29544Inparanoid, OMA, EggNOG
Mouse17765Mtf2metal response element binding transcription factor 210090MGI:105050Inparanoid, OMA, EggNOG
Rat360905Mtf2metal response element binding transcription factor 210116RGD:1304727Inparanoid, OMA, EggNOG
Dog479948MTF2metal response element binding transcription factor 29615VGNC:43467Inparanoid, OMA, EggNOG
Horse100051293MTF2metal response element binding transcription factor 29796VGNC:20409Inparanoid, OMA, EggNOG
Cow615211MTF2metal response element binding transcription factor 29913VGNC:31723Inparanoid, OMA, EggNOG
Pig100156808MTF2metal response element binding transcription factor 29823Inparanoid, OMA, EggNOG
Opossum100032821MTF2metal response element binding transcription factor 213616Inparanoid, OMA, EggNOG
Anole lizard100559589mtf2metal response element binding transcription factor 228377Inparanoid, OMA
Xenopus550093mtf2metal response element binding transcription factor 28364XB-GENE-1014957Inparanoid, OMA
Zebrafish692292mtf2metal response element binding transcription factor 27955ZDB-GENE-060512-94Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.