GTPBP4

DescripciónNucleolar GTP-binding protein 1

Gene and Protein Information

Gene ID23560
Uniprot Accession IDs Q9BZE4 B3KMC5 B4DY13 B7Z7A3 O95446 Q5T3R8 Q9NVJ8
Ensembl ID ENSP00000354040
Symbol CRFG NOG1 NGB CRFG NOG1
FamilyBelongs to the TRAFAC class OBG-HflX-like GTPase superfamily. OBG GTPase family. NOG subfamily.
Sequence
MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQILTDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQLKRAALGRMCTVIKRQKQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRADVDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGILDHPLEDRNTIEMQAITALAHLRAAVLYVMDLSEQCGHGLREQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEDDQKIFTDLQSEGFPVIETSTLTEEGVIKVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp450261GTPBP4GTP binding protein 49598VGNC:4701Inparanoid, OMA, EggNOG
Macaque709873GTPBP4GTP binding protein 49544OMA, EggNOG
Mouse69237Gtpbp4GTP binding protein 410090MGI:1916487Inparanoid, OMA, EggNOG
Rat114300Gtpbp4GTP binding protein 410116RGD:620783Inparanoid, OMA, EggNOG
Dog478021GTPBP4GTP binding protein 49615VGNC:49777Inparanoid, OMA, EggNOG
Horse100071237GTPBP4GTP binding protein 49796VGNC:18652Inparanoid, OMA, EggNOG
Cow524743GTPBP4GTP binding protein 49913VGNC:29710Inparanoid, OMA, EggNOG
Pig100625226GTPBP4GTP binding protein 49823Inparanoid, OMA
Opossum100017256GTPBP4GTP binding protein 413616Inparanoid, OMA, EggNOG
Chicken420458GTPBP4GTP binding protein 49031CGNC:5061Inparanoid, OMA, EggNOG
Anole lizard100559003gtpbp4GTP binding protein 428377Inparanoid, OMA, EggNOG
Xenopus496593gtpbp4GTP binding protein 48364XB-GENE-962819Inparanoid, OMA, EggNOG
Zebrafish334050gtpbp4GTP binding protein 47955ZDB-GENE-030131-5982Inparanoid, OMA, EggNOG
C. elegans176863nog-1Nucleolar GTP-binding protein 16239Inparanoid, OMA, EggNOG
Fruitfly35963Non1Novel nucleolar protein 17227FBgn0028473Inparanoid, EggNOG
S.cerevisiae856012NOG1putative GTPase NOG14932S000006014Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.