Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Nucleoside diphosphate kinase 3 |
|---|
Gene and Protein Information
| Gene ID | 4832 |
|---|---|
| Uniprot Accession IDs | Q13232 Q9BWH4 NDK 3 |
| Ensembl ID | ENSP00000219302 |
| Symbol | NDPKC NDPK-C NM23H3 DR-nm23 NM23-H3 c371H6.2 |
| Family | Belongs to the NDK family. |
| Sequence | MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 467867 | NME3 | NME/NM23 nucleoside diphosphate kinase 3 | 9598 | VGNC:13748 | OMA, EggNOG |
| Macaque | 722479 | NME3 | NME/NM23 nucleoside diphosphate kinase 3 | 9544 | OMA, EggNOG | |
| Mouse | 79059 | Nme3 | NME/NM23 nucleoside diphosphate kinase 3 | 10090 | MGI:1930182 | Inparanoid, OMA, EggNOG |
| Rat | 85269 | Nme3 | NME/NM23 nucleoside diphosphate kinase 3 | 10116 | RGD:619879 | Inparanoid, OMA, EggNOG |
| Dog | 100856596 | NME3 | NME/NM23 nucleoside diphosphate kinase 3 | 9615 | VGNC:54050 | Inparanoid, OMA, EggNOG |
| Cow | 515663 | NME3 | NME/NM23 nucleoside diphosphate kinase 3 | 9913 | VGNC:32126 | Inparanoid, OMA, EggNOG |
| Pig | 100514398 | NME3 | NME/NM23 nucleoside diphosphate kinase 3 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100010534 | NME3 | NME/NM23 nucleoside diphosphate kinase 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 416399 | NME3 | NME/NM23 nucleoside diphosphate kinase 3 | 9031 | CGNC:66258 | Inparanoid, OMA |
| Xenopus | 448695 | nme3 | NME/NM23 nucleoside diphosphate kinase 3 | 8364 | XB-GENE-999215 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30085 | nme3 | NME/NM23 nucleoside diphosphate kinase 3 | 7955 | ZDB-GENE-000210-34 | Inparanoid, OMA |
| S.cerevisiae | 853798 | YNK1 | nucleoside diphosphate kinase | 4932 | S000001550 | Inparanoid, OMA |
Protein Classes
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.