Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 4724 |
|---|---|
| Uniprot Accession IDs | O43181 Q9BS69 |
| Ensembl ID | ENSP00000296684 |
| Symbol | AQDQ CI-18 MC1DN1 CI-AQDQ CI-18 kDa |
| Family | Belongs to the complex I NDUFS4 subunit family. |
| Sequence | MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 461878 | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 | 9598 | VGNC:4096 | Inparanoid, OMA, EggNOG |
| Macaque | 704137 | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 17993 | Ndufs4 | NADH:ubiquinone oxidoreductase core subunit S4 | 10090 | MGI:1343135 | Inparanoid, OMA, EggNOG |
| Rat | 499529 | Ndufs4 | NADH:ubiquinone oxidoreductase subunit S4 | 10116 | RGD:1594380 | Inparanoid, OMA, EggNOG |
| Dog | 479335 | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 | 9615 | VGNC:52003 | Inparanoid, OMA, EggNOG |
| Horse | 100063168 | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 | 9796 | VGNC:49499 | Inparanoid, OMA, EggNOG |
| Cow | 327680 | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 | 9913 | VGNC:50229 | Inparanoid, OMA, EggNOG |
| Opossum | 100031559 | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 [Source:HGNC Symbol;Acc:HGNC:7711] | 9258 | OMA, EggNOG | ||
| Chicken | 374122 | NDUFS4 | NADH:ubiquinone oxidoreductase subunit S4 | 9031 | CGNC:66185 | Inparanoid, OMA |
| Anole lizard | 100558063 | ndufs4 | NADH:ubiquinone oxidoreductase subunit S4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100125122 | ndufs4 | NADH:ubiquinone oxidoreductase subunit S4 | 8364 | XB-GENE-947419 | Inparanoid, OMA, EggNOG |
| Zebrafish | 573689 | ndufs4 | NADH dehydrogenase (ubiquinone) Fe-S protein 4, (NADH-coenzyme Q reductase) | 7955 | ZDB-GENE-050522-421 | Inparanoid, OMA, EggNOG |
| C. elegans | 172037 | lpd-5 | LiPid Depleted | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.