🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

NCR1

DescripciónNatural cytotoxicity triggering receptor 1

Gene and Protein Information

Gene ID9437
Uniprot Accession IDs O76036 B0V3L2 B0V3L3 B0V3L4 B0V3L5 B8JL03 O76016 O76017 O76018
Ensembl ID ENSP00000291890
Symbol LY94 LY94 CD335 NKP46 NK-p46
FamilyBelongs to the natural cytotoxicity receptor (NCR) family.
Sequence
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp100322885NCR1natural cytotoxicity triggering receptor 19598VGNC:11197Inparanoid, OMA, EggNOG
Macaque574242NCR1natural cytotoxicity triggering receptor 19544OMA, EggNOG
Mouse17086Ncr1natural cytotoxicity triggering receptor 110090MGI:1336212Inparanoid, OMA, EggNOG
Rat117547Ncr1natural cytotoxicity triggering receptor 110116RGD:621288Inparanoid, OMA, EggNOG
Dog611390NCR1natural cytotoxicity triggering receptor 19615VGNC:53740Inparanoid, OMA, EggNOG
Horse100054918NCR1natural cytotoxicity triggering receptor 19796VGNC:20603Inparanoid, OMA, EggNOG
Cow369024NCR1natural cytotoxicity triggering receptor 19913VGNC:31926Inparanoid, OMA, EggNOG
Pig100141419NCR1natural cytotoxicity triggering receptor 19823Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    defense/immunity protein    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    membrane-bound signaling molecule    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    protease inhibitor    /    Natural cytotoxicity triggering receptor 1
protein    /    receptor    /    cytokine receptor    /    Natural cytotoxicity triggering receptor 1
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    Natural cytotoxicity triggering receptor 1

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.