🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

PNP

DescripciónPurine nucleoside phosphorylase

Gene and Protein Information

Gene ID4860
Uniprot Accession IDs P00491 B2R8S5 D3DS00 Q15160 Q5PZ03 PNP
Ensembl ID ENSP00000354532
Symbol NP NP PUNP PRO1837
FamilyBelongs to the PNP/MTAP phosphorylase family.
Sequence
MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp737850PNPpurine nucleoside phosphorylase9598VGNC:3356OMA, EggNOG
Mouse667034Pnp2purine-nucleoside phosphorylase 210090MGI:3712328Inparanoid, OMA, EggNOG
Rat290029Pnppurine nucleoside phosphorylase10116RGD:1597189Inparanoid, OMA, EggNOG
Dog475393PNPpurine nucleoside phosphorylase9615VGNC:44751OMA, EggNOG
Horse100072592LOC100072592purine nucleoside phosphorylase-like9796Inparanoid, OMA, EggNOG
Cow493724PNPpurine nucleoside phosphorylase9913OMA, EggNOG
Pig100157138PNPpurine nucleoside phosphorylase9823OMA, EggNOG
Platypus100084590PNPpurine nucleoside phosphorylase9258Inparanoid, EggNOG
Anole lizard100567275pnppurine nucleoside phosphorylase28377Inparanoid, OMA, EggNOG
Xenopus448370pnppurine nucleoside phosphorylase8364XB-GENE-1011598OMA, EggNOG
Zebrafish791647pnp5apurine nucleoside phosphorylase 5a7955ZDB-GENE-040426-2553Inparanoid, EggNOG
S.cerevisiae850906PNP1purine-nucleoside phosphorylase4932S000004199Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    phosphorylase    /    Purine nucleoside phosphorylase
DTO Classes
protein    /    Enzyme    /    Transferase    /    Phosphorylase    /    Purine nucleoside phosphorylase

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.