224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Neuronatin |
|---|
Gene and Protein Information
| Gene ID | 4826 |
|---|---|
| Uniprot Accession IDs | Q16517 B2R558 E1P5V6 Q16596 Q5U0N3 |
| Ensembl ID | ENSP00000062104 |
| Symbol | Peg5 |
| Family | Belongs to the neuronatin family. |
| Sequence | MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458231 | NNAT | neuronatin | 9598 | VGNC:14266 | OMA, EggNOG |
| Macaque | 700562 | NNAT | neuronatin | 9544 | OMA, EggNOG | |
| Mouse | 18111 | Nnat | neuronatin | 10090 | MGI:104716 | Inparanoid, EggNOG |
| Rat | 94270 | Nnat | neuronatin | 10116 | RGD:620155 | Inparanoid, OMA, EggNOG |
| Dog | 609195 | NNAT | neuronatin | 9615 | VGNC:43868 | Inparanoid, OMA, EggNOG |
| Horse | 100055414 | NNAT | neuronatin | 9796 | VGNC:20788 | Inparanoid, OMA, EggNOG |
| Cow | 353114 | NNAT | neuronatin | 9913 | VGNC:32142 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.