🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

PNPO

DescripciónPyridoxine-5'-phosphate oxidase

Gene and Protein Information

Gene ID55163
Uniprot Accession IDs Q9NVS9 B4E0V0 B4E152 B4E1D7 D3DTT9
Ensembl ID ENSP00000225573
Symbol PDXPO HEL-S-302
FamilyBelongs to the pyridoxamine 5'-phosphate oxidase family.
Sequence
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp749248PNPOpyridoxamine 5'-phosphate oxidase9598VGNC:9532OMA, EggNOG
Macaque694949PNPOpyridoxamine 5'-phosphate oxidase9544OMA, EggNOG
Mouse103711Pnpopyridoxine 5'-phosphate oxidase10090MGI:2144151OMA, EggNOG
Rat64533Pnpopyridoxamine 5'-phosphate oxidase10116RGD:621456OMA, EggNOG
Dog480540PNPOpyridoxamine 5'-phosphate oxidase9615VGNC:44759OMA, EggNOG
Horse100055489PNPOpyridoxamine 5'-phosphate oxidase9796VGNC:21639OMA, EggNOG
Cow512573PNPOpyridoxamine 5'-phosphate oxidase9913VGNC:33096OMA, EggNOG
Opossum100020042PNPOpyridoxamine 5'-phosphate oxidase13616OMA, EggNOG
PlatypusPNPOpyridoxamine 5'-phosphate oxidase [Source:HGNC Symbol;Acc:HGNC:30260]9258OMA, EggNOG
Anole lizard100551742pnpopyridoxamine 5'-phosphate oxidase28377OMA, EggNOG
Xenopus100144978pnpopyridoxamine 5'-phosphate oxidase8364XB-GENE-955839OMA, EggNOG
Zebrafish402868pnpopyridoxamine 5'-phosphate oxidase7955ZDB-GENE-060602-2OMA, EggNOG
S.cerevisiae852323PDX3pyridoxamine-phosphate oxidase PDX34932S000000239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxidase    /    Pyridoxine-5'-phosphate oxidase
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxidase    /    Pyridoxine-5'-phosphate oxidase

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.