🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

NDUFB2

DescripciónNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

Gene and Protein Information

Gene ID4708
Uniprot Accession IDs O95178 Q6FGI6
Ensembl ID ENSP00000419087
Symbol AGGG CI-AGGG
FamilyBelongs to the complex I NDUFB2 subunit family.
Sequence
MSALTRLASFARVGGRLFRSGCARTAGDGGVRHAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp463780NDUFB2NADH:ubiquinone oxidoreductase subunit B29598VGNC:4441Inparanoid, OMA, EggNOG
Macaque693431NDUFB2NADH:ubiquinone oxidoreductase subunit B29544Inparanoid, OMA, EggNOG
Mouse68198Ndufb2NADH:ubiquinone oxidoreductase subunit B210090MGI:1915448Inparanoid, OMA, EggNOG
Rat362344Ndufb2NADH:ubiquinone oxidoreductase subunit B210116RGD:1308130Inparanoid, OMA, EggNOG
Dog100683846NDUFB2NADH:ubiquinone oxidoreductase subunit B29615VGNC:43701Inparanoid, OMA, EggNOG
Horse100064695NDUFB2NADH:ubiquinone oxidoreductase subunit B29796VGNC:20638Inparanoid, OMA, EggNOG
Cow327713NDUFB2NADH:ubiquinone oxidoreductase subunit B29913VGNC:31962Inparanoid, OMA, EggNOG
Pig100513895NDUFB2NADH:ubiquinone oxidoreductase subunit B29823Inparanoid, EggNOG
OpossumNDUFB2NADH:ubiquinone oxidoreductase subunit B2 [Source:HGNC Symbol;Acc:HGNC:7697]13616Inparanoid, OMA, EggNOG
Anole lizard100559985ndufb2NADH:ubiquinone oxidoreductase subunit B228377Inparanoid, OMA, EggNOG
Xenopus100127720ndufb2NADH:ubiquinone oxidoreductase subunit B28364XB-GENE-1009607Inparanoid, EggNOG
Zebrafish393764ndufb2NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 27955ZDB-GENE-040426-1762OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.