🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

NAA50

DescripciónN-alpha-acetyltransferase 50

Gene and Protein Information

Gene ID80218
Uniprot Accession IDs Q9GZZ1 D3DN74 Q68DQ1 hNaa50p
Ensembl ID ENSP00000240922
Symbol MAK3 NAT13 NAT5 SAN MAK3 NAT5 NAT13 NAT5P NAT13P hNaa50p
FamilyBelongs to the acetyltransferase family. GNAT subfamily.
Sequence
MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque709764NAA50N(alpha)-acetyltransferase 50, NatE catalytic subunit9544Inparanoid, OMA, EggNOG
Mouse72117Naa50N(alpha)-acetyltransferase 50, NatE catalytic subunit10090MGI:1919367Inparanoid, OMA, EggNOG
Rat288108Naa50N(alpha)-acetyltransferase 50, NatE catalytic subunit10116RGD:1310944Inparanoid, OMA
RatAABR07034273.1-10116OMA, EggNOG
Horse100071372NAA50N(alpha)-acetyltransferase 50, NatE catalytic subunit9796Inparanoid, OMA, EggNOG
Cow517211NAA50N(alpha)-acetyltransferase 50, NatE catalytic subunit9913VGNC:53590Inparanoid, OMA, EggNOG
Pig100513438NAA50N(alpha)-acetyltransferase 50, NatE catalytic subunit9823Inparanoid, OMA, EggNOG
Opossum100013194NAA50N(alpha)-acetyltransferase 50, NatE catalytic subunit13616Inparanoid, OMA, EggNOG
Platypus100086792NAA50N(alpha)-acetyltransferase 50, NatE catalytic subunit9258Inparanoid, OMA
Anole lizard100554642naa50N(alpha)-acetyltransferase 50, NatE catalytic subunit28377Inparanoid, OMA, EggNOG
Xenopus496547naa50N(alpha)-acetyltransferase 50, NatE catalytic subunit8364XB-GENE-996002Inparanoid, OMA, EggNOG
Zebrafish445229naa50N(alpha)-acetyltransferase 50, NatE catalytic subunit7955ZDB-GENE-040801-142Inparanoid, OMA, EggNOG
Fruitfly44724sanseparation anxiety7227FBgn0024188Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transferase    /    acetyltransferase    /    N-alpha-acetyltransferase 50
DTO Classes
protein    /    Enzyme    /    Transferase    /    Acetyltransferase    /    N-alpha-acetyltransferase 50

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.