🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

MKRN2

DescripciónProbable E3 ubiquitin-protein ligase makorin-2

Gene and Protein Information

Gene ID23609
Uniprot Accession IDs Q9H000 A6NIA2 B3KRC5 B4DPR4 Q8N391 Q96BD4 Q9BUY2 Q9NRY1
Ensembl ID ENSP00000170447
Symbol RNF62 RNF62 HSPC070
Sequence
MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp460180MKRN2makorin ring finger protein 29598VGNC:2048OMA, EggNOG
Macaque697649MKRN2makorin ring finger protein 29544Inparanoid, OMA, EggNOG
Mouse67027Mkrn2makorin, ring finger protein, 210090MGI:1914277Inparanoid, OMA, EggNOG
Rat297525Mkrn2makorin, ring finger protein, 210116RGD:1310618Inparanoid, OMA, EggNOG
Dog476531MKRN2makorin ring finger protein 29615VGNC:43252Inparanoid, OMA, EggNOG
Horse100057038MKRN2makorin ring finger protein 29796VGNC:20205Inparanoid, OMA
Cow508004MKRN2makorin ring finger protein 29913Inparanoid, OMA
Pig100626891MKRN2makorin ring finger protein 29823Inparanoid, OMA
Opossum100025193MKRN2makorin ring finger protein 213616Inparanoid, OMA
Chicken374162MKRN2makorin ring finger protein 29031CGNC:3707Inparanoid, OMA, EggNOG
Anole lizard100557415mkrn2makorin ring finger protein 228377Inparanoid, OMA, EggNOG
Zebrafish170783mkrn2makorin, ring finger protein, 27955ZDB-GENE-020213-2Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    ligase    /    ubiquitin-protein ligase    /    Probable E3 ubiquitin-protein ligase makorin-2
DTO Classes
protein    /    Enzyme    /    Ligase    /    Ubiquitin-protein ligase    /    Probable E3 ubiquitin-protein ligase makorin-2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.