224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Podoplanin |
|---|
Gene and Protein Information
| Gene ID | 10630 |
|---|---|
| Uniprot Accession IDs | Q86YL7 A9Z1Y2 B2R6J8 E9PB68 F6QWX5 O60836 O95128 Q7L375 Q8NBQ8 Q8NBR3 |
| Ensembl ID | ENSP00000294489 |
| Symbol | GP36 T1A GP36 GP40 Gp38 OTS8 T1A2 TI1A T1A-2 AGGRUS HT1A-1 PA2.26 |
| Family | Belongs to the podoplanin family. |
| Sequence | MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 716250 | PDPN | podoplanin | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 14726 | Pdpn | podoplanin | 10090 | MGI:103098 | Inparanoid, OMA, EggNOG |
| Rat | 54320 | Pdpn | podoplanin | 10116 | RGD:61819 | Inparanoid, OMA, EggNOG |
| Dog | 403886 | PDPN | podoplanin | 9615 | VGNC:52226 | Inparanoid, OMA, EggNOG |
| Cow | 509732 | PDPN | podoplanin | 9913 | VGNC:50142 | OMA, EggNOG |
| Pig | 100738269 | PDPN | podoplanin | 9823 | OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.