224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | CCR4-NOT transcription complex subunit 4 |
|---|
Gene and Protein Information
| Gene ID | 4850 |
|---|---|
| Uniprot Accession IDs | O95628 B7Z6I4 E7ET38 F8VQP3 O95339 O95627 Q8IYM7 Q8NCL0 Q9NPQ1 Q9NZN6 |
| Ensembl ID | ENSP00000445508 |
| Symbol | NOT4 NOT4 NOT4H CLONE243 |
| Sequence | MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPLSQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDCMYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 463751 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9598 | VGNC:7368 | OMA, EggNOG |
| Macaque | 708011 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 53621 | Cnot4 | CCR4-NOT transcription complex, subunit 4 | 10090 | MGI:1859026 | Inparanoid, OMA, EggNOG |
| Rat | 312227 | Cnot4 | CCR4-NOT transcription complex, subunit 4 | 10116 | RGD:1310318 | Inparanoid, OMA, EggNOG |
| Dog | 482708 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9615 | VGNC:39415 | Inparanoid, OMA, EggNOG |
| Horse | 100065026 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9796 | VGNC:16677 | Inparanoid, OMA, EggNOG |
| Cow | 540891 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9913 | VGNC:27519 | Inparanoid, OMA, EggNOG |
| Opossum | 100016711 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100081604 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 417936 | CNOT4 | CCR4-NOT transcription complex subunit 4 | 9031 | CGNC:8877 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553912 | cnot4 | CCR4-NOT transcription complex subunit 4 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 594959 | cnot4 | CCR4-NOT transcription complex subunit 4 | 8364 | XB-GENE-947788 | Inparanoid, OMA, EggNOG |
| Fruitfly | 34416 | Cnot4 | CCR4-NOT transcription complex subunit 4 | 7227 | FBgn0051716 | Inparanoid, EggNOG |
| S.cerevisiae | 856799 | MOT2 | CCR4-NOT core ubiquitin-protein ligase subunit MOT2 | 4932 | S000000870 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.