224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Dynactin subunit 5 |
|---|
Gene and Protein Information
| Gene ID | 84516 |
|---|---|
| Uniprot Accession IDs | Q9BTE1 A8K9X8 H3BN51 H3BQA4 |
| Ensembl ID | ENSP00000300087 |
| Family | Belongs to the dynactin subunits 5/6 family. Dynactin subunit 5 subfamily. |
| Sequence | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 698277 | DCTN5 | dynactin subunit 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 59288 | Dctn5 | dynactin 5 | 10090 | MGI:1891689 | Inparanoid, OMA, EggNOG |
| Rat | 308961 | Dctn5 | dynactin subunit 5 | 10116 | RGD:1305654 | Inparanoid, OMA |
| Dog | 479804 | DCTN5 | dynactin subunit 5 | 9615 | VGNC:39820 | Inparanoid, OMA, EggNOG |
| Horse | 100068373 | DCTN5 | dynactin subunit 5 | 9796 | VGNC:17059 | Inparanoid, OMA, EggNOG |
| Cow | 506441 | DCTN5 | dynactin subunit 5 | 9913 | VGNC:27932 | OMA, EggNOG |
| Opossum | 100019570 | DCTN5 | dynactin subunit 5 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100073579 | DCTN5 | dynactin subunit 5 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 416574 | DCTN5 | dynactin subunit 5 | 9031 | CGNC:4566 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563763 | dctn5 | dynactin subunit 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496622 | dctn5 | dynactin subunit 5 | 8364 | XB-GENE-963961 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436770 | dctn5 | dynactin 5 | 7955 | ZDB-GENE-040718-201 | Inparanoid, OMA, EggNOG |
| C. elegans | 171856 | dnc-5 | DyNactin Complex component | 6239 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.