COX5B

DescripciónCytochrome c oxidase subunit 5B, mitochondrial

Gene and Protein Information

Gene ID1329
Uniprot Accession IDs P10606 Q53YB7 Q96J18 Q99610
Ensembl ID ENSP00000258424
Symbol COXVB
FamilyBelongs to the cytochrome c oxidase subunit 5B family.
Sequence
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp741789COX5Bcytochrome c oxidase subunit 5B9598VGNC:10525OMA, EggNOG
Mouse12859Cox5bcytochrome c oxidase subunit Vb10090MGI:88475Inparanoid, OMA
Mouse100040340Gm11273predicted gene 1127310090MGI:3649411OMA, EggNOG
Rat94194Cox5bcytochrome c oxidase subunit 5B10116RGD:620608Inparanoid, OMA, EggNOG
Dog474567COX5Bcytochrome c oxidase subunit 5B9615VGNC:39540Inparanoid, OMA, EggNOG
Horse100061973COX5Bcytochrome c oxidase subunit 5B9796VGNC:16804Inparanoid, OMA, EggNOG
Cow287012COX5Bcytochrome c oxidase subunit Vb9913Inparanoid, OMA, EggNOG
Pig492822COX5Bmitochondrial cytochrome c oxidase subunit Vb9823Inparanoid, OMA, EggNOG
Anole lizard100563950LOC100563950cytochrome c oxidase subunit 5B, mitochondrial28377Inparanoid, OMA, EggNOG
Xenopus549004cox5b.1cytochrome c oxidase subunit Vb, gene 18364XB-GENE-964002OMA, EggNOG
Zebrafish415253zgc:86599zgc:865997955ZDB-GENE-040625-180Inparanoid, OMA, EggNOG
C. elegans172832cox-5BCytochrome OXidase assembly protein6239OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxidase    /    Cytochrome c oxidase subunit 5B, mitochondrial
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxidase    /    Cytochrome c oxidase subunit 5B, mitochondrial

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.