The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
COX5B Descripción Cytochrome c oxidase subunit 5B, mitochondrial
Gene and Protein Information Gene ID 1329 Uniprot Accession IDs P10606 Q53YB7 Q96J18 Q99610 Ensembl ID ENSP00000258424 Symbol COXVB Family Belongs to the cytochrome c oxidase subunit 5B family. Sequence MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 741789 COX5B cytochrome c oxidase subunit 5B 9598 VGNC:10525 OMA, EggNOG Mouse 12859 Cox5b cytochrome c oxidase subunit Vb 10090 MGI:88475 Inparanoid, OMA Mouse 100040340 Gm11273 predicted gene 11273 10090 MGI:3649411 OMA, EggNOG Rat 94194 Cox5b cytochrome c oxidase subunit 5B 10116 RGD:620608 Inparanoid, OMA, EggNOG Dog 474567 COX5B cytochrome c oxidase subunit 5B 9615 VGNC:39540 Inparanoid, OMA, EggNOG Horse 100061973 COX5B cytochrome c oxidase subunit 5B 9796 VGNC:16804 Inparanoid, OMA, EggNOG Cow 287012 COX5B cytochrome c oxidase subunit Vb 9913 Inparanoid, OMA, EggNOG Pig 492822 COX5B mitochondrial cytochrome c oxidase subunit Vb 9823 Inparanoid, OMA, EggNOG Anole lizard 100563950 LOC100563950 cytochrome c oxidase subunit 5B, mitochondrial 28377 Inparanoid, OMA, EggNOG Xenopus 549004 cox5b.1 cytochrome c oxidase subunit Vb, gene 1 8364 XB-GENE-964002 OMA, EggNOG Zebrafish 415253 zgc:86599 zgc:86599 7955 ZDB-GENE-040625-180 Inparanoid, OMA, EggNOG C. elegans 172832 cox-5B Cytochrome OXidase assembly protein 6239 OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.