🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CALB2

DescriptionCalretinin

Gene and Protein Information

Gene ID794
Uniprot Accession IDs P22676 A8K4Y1 Q53HD2 Q96BK4 CR
Ensembl ID ENSP00000307508
Symbol CAB29 CR CAL2 CAB29
FamilyBelongs to the calbindin family.
Sequence
MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp454224CALB2calbindin 29598VGNC:13672OMA, EggNOG
Mouse12308Calb2calbindin 210090MGI:101914Inparanoid, OMA, EggNOG
Rat117059Calb2calbindin 210116RGD:620981Inparanoid, OMA, EggNOG
Dog610586CALB2calbindin 29615VGNC:38661Inparanoid, OMA, EggNOG
Horse100068401CALB2calbindin 29796VGNC:16004Inparanoid, OMA, EggNOG
Cow513947CALB2calbindin 29913VGNC:26701Inparanoid, OMA, EggNOG
Pig100127479CALB2calbindin 29823Inparanoid, OMA, EggNOG
Opossum100011674CALB2calbindin 213616Inparanoid, EggNOG
PlatypusCALB2calbindin 2 [Source:HGNC Symbol;Acc:HGNC:1435]9258OMA, EggNOG
Chicken396255CALB2calbindin 29031CGNC:66223Inparanoid, OMA
Zebrafish393691calb2acalbindin 2a7955ZDB-GENE-040426-1677Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.