🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CA5A

DescripciónCarbonic anhydrase 5A, mitochondrial

Gene and Protein Information

Gene ID763
Uniprot Accession IDs P35218 B2RPF2
Ensembl ID ENSP00000309649
Symbol CA5 CA5 CAV CAVA CA5AD GS1-21A4.1
FamilyBelongs to the alpha-carbonic anhydrase family.
Sequence
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp468095CA5Acarbonic anhydrase 5A9598VGNC:9075OMA, EggNOG
Mouse12352Car5acarbonic anhydrase 5a, mitochondrial10090MGI:101946Inparanoid, OMA, EggNOG
Rat54233Car5acarbonic anhydrase 5A10116RGD:2243Inparanoid, OMA, EggNOG
Dog609174CA5Acarbonic anhydrase 5A9615VGNC:53312Inparanoid, OMA, EggNOG
Horse100070642CA5Acarbonic anhydrase 5A9796VGNC:49304Inparanoid, OMA, EggNOG
Cow515359CA5Acarbonic anhydrase 5A9913VGNC:50002Inparanoid, OMA, EggNOG
Opossum100025662CA5Acarbonic anhydrase 5A13616Inparanoid, EggNOG
PlatypusCA5Acarbonic anhydrase 5A [Source:HGNC Symbol;Acc:HGNC:1377]9258OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.