224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Calcineurin subunit B type 2 |
|---|
Gene and Protein Information
| Gene ID | 5535 |
|---|---|
| Uniprot Accession IDs | Q96LZ3 Q5VTR4 Q7Z4V8 Q8WYJ4 |
| Ensembl ID | ENSP00000363939 |
| Symbol | CBLP PPP3RL PPP3RL |
| Family | Belongs to the calcineurin regulatory subunit family. |
| Sequence | MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 19059 | Ppp3r2 | protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type II) | 10090 | MGI:107171 | OMA, EggNOG |
| Rat | 29749 | Ppp3r2 | protein phosphatase 3, regulatory subunit B, beta | 10116 | RGD:69232 | Inparanoid, OMA |
| S.cerevisiae | 853644 | CNB1 | calcineurin regulatory subunit B | 4932 | S000001673 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.