🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CTSZ

DescripciónCathepsin Z

Gene and Protein Information

Gene ID1522
Uniprot Accession IDs Q9UBR2 B2RC40 O75331 Q9UQV5 Q9UQV6
Ensembl ID ENSP00000217131
Symbol CTSX
FamilyBelongs to the peptidase C1 family.
Sequence
MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp736240CTSZcathepsin Z9598VGNC:6087OMA, EggNOG
Macaque694157CTSZcathepsin Z9544OMA, EggNOG
Mouse64138Ctszcathepsin Z10090MGI:1891190Inparanoid, OMA, EggNOG
Rat252929Ctszcathepsin Z10116RGD:708479Inparanoid, OMA, EggNOG
Dog611983CTSZcathepsin Z9615VGNC:39717Inparanoid, OMA, EggNOG
Horse100056600CTSZcathepsin Z9796VGNC:16957Inparanoid, OMA, EggNOG
Cow404187CTSZcathepsin Z9913VGNC:27820Inparanoid, OMA, EggNOG
Pig100141405CTSZcathepsin Z9823Inparanoid, OMA, EggNOG
Opossum100027054CTSZcathepsin Z13616Inparanoid, EggNOG
Chicken419311CTSZcathepsin Z9031CGNC:5626Inparanoid, OMA, EggNOG
Xenopus100127597ctszcathepsin Z8364XB-GENE-959211Inparanoid, OMA, EggNOG
Zebrafish450022ctszcathepsin Z7955ZDB-GENE-041010-139Inparanoid, OMA, EggNOG
C. elegans171829cpz-1CathePsin Z6239Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.