224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Carboxypeptidase N catalytic chain |
|---|
Gene and Protein Information
| Gene ID | 1369 |
|---|---|
| Uniprot Accession IDs | P15169 B1AP59 CPN |
| Ensembl ID | ENSP00000359446 |
| Symbol | ACBP CPN SCPN |
| Family | Belongs to the peptidase M14 family. |
| Sequence | MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 709434 | CPN1 | carboxypeptidase N subunit 1 | 9544 | OMA, EggNOG | |
| Mouse | 93721 | Cpn1 | carboxypeptidase N, polypeptide 1 | 10090 | MGI:2135874 | Inparanoid, OMA, EggNOG |
| Rat | 365466 | Cpn1 | carboxypeptidase N subunit 1 | 10116 | RGD:70931 | Inparanoid, OMA, EggNOG |
| Dog | 477795 | CPN1 | carboxypeptidase N subunit 1 | 9615 | VGNC:39558 | Inparanoid, OMA, EggNOG |
| Horse | 100070412 | CPN1 | carboxypeptidase N subunit 1 | 9796 | VGNC:50662 | Inparanoid, OMA, EggNOG |
| Cow | 536753 | CPN1 | carboxypeptidase N subunit 1 | 9913 | VGNC:27656 | Inparanoid, OMA, EggNOG |
| Pig | 100157984 | CPN1 | carboxypeptidase N subunit 1 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100020383 | CPN1 | carboxypeptidase N subunit 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 769143 | CPN1 | carboxypeptidase N subunit 1 | 9031 | CGNC:5352 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563397 | cpn1 | carboxypeptidase N subunit 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 550020 | cpn1 | carboxypeptidase N subunit 1 | 8364 | XB-GENE-967670 | Inparanoid, OMA, EggNOG |
| Zebrafish | 337172 | cpn1 | carboxypeptidase N, polypeptide 1 | 7955 | ZDB-GENE-030131-9116 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.