🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CBX3

DescripciónChromobox protein homolog 3

Gene and Protein Information

Gene ID11335
Uniprot Accession IDs Q13185 Q96CD7 Q99409 Q9BVS3 Q9P0Z6
Ensembl ID ENSP00000336687
Symbol HECH HP1-GAMMA HP1Hs-gamma
Sequence
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp463300CBX3chromobox 39598VGNC:4297OMA, EggNOG
Macaque695847LOC695847chromobox protein homolog 3-like9544OMA, EggNOG
Mouse12417Cbx3chromobox 310090MGI:108515Inparanoid, OMA, EggNOG
Dog482015CBX3chromobox 39615Inparanoid, OMA, EggNOG
Horse100054158CBX3chromobox 39796VGNC:51930Inparanoid, OMA, EggNOG
Cow539788CBX3chromobox 39913VGNC:50017Inparanoid, OMA, EggNOG
Pig100622432CBX3chromobox 39823OMA, EggNOG
Opossum100010415CBX3chromobox 313616Inparanoid, OMA, EggNOG
Platypus100079167CBX3chromobox 39258Inparanoid, OMA, EggNOG
Chicken395355CBX3chromobox 39031CGNC:8386Inparanoid, OMA
Anole lizard100561447cbx3chromobox 328377Inparanoid, OMA, EggNOG
Xenopus100038121cbx3chromobox 38364XB-GENE-492315Inparanoid, OMA, EggNOG
Zebrafish751689cbx3achromobox homolog 3a (HP1 gamma homolog, Drosophila)7955ZDB-GENE-030131-1158Inparanoid, OMA
C. elegans181450hpl-1HP1 Like (heterochromatin protein)6239OMA, EggNOG

Protein Classes

DTO Classes
protein    /    Epigenetic regulator    /    Reader    /    Methyl-lysine/arginine binding protein    /    Chromodomain    /    Chromobox protein homolog 3

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.