🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

BMP6

DescripciónBone morphogenetic protein 6

Gene and Protein Information

Gene ID654
Uniprot Accession IDs P22004 Q5TCP3 BMP-6
Ensembl ID ENSP00000283147
Symbol VGR VGR VGR1
FamilyBelongs to the TGF-beta family.
Sequence
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp471851BMP6bone morphogenetic protein 69598VGNC:2649OMA, EggNOG
Macaque695091BMP6bone morphogenetic protein 69544Inparanoid, OMA, EggNOG
Mouse12161Bmp6bone morphogenetic protein 610090MGI:88182Inparanoid, OMA, EggNOG
Rat25644Bmp6bone morphogenetic protein 610116RGD:2214Inparanoid, OMA, EggNOG
Horse100033934BMP6bone morphogenetic protein 69796Inparanoid, EggNOG
Cow617566BMP6bone morphogenetic protein 69913VGNC:26521Inparanoid, OMA, EggNOG
Pig100155536BMP6bone morphogenetic protein 69823Inparanoid, OMA, EggNOG
Opossum100020435BMP6bone morphogenetic protein 613616Inparanoid, OMA, EggNOG
Chicken420868BMP6bone morphogenetic protein 69031CGNC:9693Inparanoid, EggNOG
Anole lizardBMP6bone morphogenetic protein 6 [Source:HGNC Symbol;Acc:HGNC:1073]28377Inparanoid, EggNOG
Xenopus100127176bmp6bone morphogenetic protein 68364XB-GENE-479134Inparanoid, OMA, EggNOG
Zebrafish503761bmp6bone morphogenetic protein 67955ZDB-GENE-050306-42OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    growth factor    /    Bone morphogenetic protein 6
DTO Classes
protein    /    Signaling    /    Growth factor    /    Bone morphogenetic protein 6

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.