🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

C1QB

DescripciónComplement C1q subcomponent subunit B

Gene and Protein Information

Gene ID713
Uniprot Accession IDs P02746 Q5T959 Q96H17
Ensembl ID ENSP00000313967
Sequence
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Mouse12260C1qbcomplement component 1, q subcomponent, beta polypeptide10090MGI:88224Inparanoid, OMA, EggNOG
Rat29687C1qbcomplement C1q B chain10116RGD:2229Inparanoid, OMA, EggNOG
Dog487381C1QBcomplement C1q B chain9615VGNC:38577Inparanoid, OMA, EggNOG
Horse100071667C1QBcomplement C1q B chain9796VGNC:15937Inparanoid, OMA, EggNOG
Cow617435C1QBcomplement C1q B chain9913VGNC:26617Inparanoid, OMA, EggNOG
Opossum100029312C1QBcomplement C1q B chain13616Inparanoid, OMA, EggNOG
Chicken428197C1QBcomplement C1q B chain9031CGNC:3540Inparanoid, OMA, EggNOG
Xenopusc1qbcomplement C1q B chain [Source:Xenbase;Acc:XB-GENE-6251287]8364OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.