🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD276

DescripciónCD276 antigen

Gene and Protein Information

Gene ID80381
Uniprot Accession IDs Q5ZPR3 Q6P5Y4 Q6UXI2 Q8NBI8 Q8NC34 Q8NCB6 Q9BXR1
Ensembl ID ENSP00000320084
Symbol B7H3 B7H3 B7-H3 B7RP-2 4Ig-B7-H3
FamilyBelongs to the immunoglobulin superfamily. BTN/MOG family.
Sequence
MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp467818CD276CD276 molecule9598VGNC:3569OMA, EggNOG
Macaque699877CD276CD276 molecule9544Inparanoid, OMA, EggNOG
Mouse102657Cd276CD276 antigen10090MGI:2183926Inparanoid, EggNOG
Rat315716Cd276Cd276 molecule10116RGD:727815Inparanoid, EggNOG
Dog487638CD276CD276 molecule9615VGNC:38943Inparanoid, OMA, EggNOG
Horse100052046CD276CD276 molecule9796VGNC:50583Inparanoid, EggNOG
Cow508656CD276CD276 molecule9913VGNC:27020Inparanoid, OMA, EggNOG
Anole lizard100560938cd276CD276 molecule28377Inparanoid, EggNOG
Xenopus100101669cd276CD276 molecule8364XB-GENE-921537Inparanoid, EggNOG
Zebrafish791140cd276CD276 molecule7955ZDB-GENE-070112-452Inparanoid, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.