🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD28

DescripciónT-cell-specific surface glycoprotein CD28

Gene and Protein Information

Gene ID940
Uniprot Accession IDs P10747 A8KAC1 Q13964 Q52M23 Q70WG0 Q8NI54 Q8NI55 Q8NI56 Q8WXJ2 Q9BYV0
Ensembl ID ENSP00000324890
Symbol Tp44
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp470617CD28CD28 molecule9598VGNC:127OMA, EggNOG
Macaque705313CD28CD28 molecule9544Inparanoid, OMA, EggNOG
Mouse12487Cd28CD28 antigen10090MGI:88327Inparanoid, OMA, EggNOG
Rat25660Cd28Cd28 molecule10116RGD:2299Inparanoid, OMA, EggNOG
Dog403646CD28CD28 molecule9615VGNC:38944Inparanoid, OMA, EggNOG
Horse100067829CD28CD28 molecule9796VGNC:16257Inparanoid, OMA, EggNOG
Cow281050CD28CD28 molecule9913VGNC:27021Inparanoid, OMA, EggNOG
Pig100515419CD28CD28 molecule9823OMA, EggNOG
Opossum100017932CD28CD28 molecule13616Inparanoid, OMA, EggNOG
Platypus100082570CD28CD28 molecule9258Inparanoid, OMA, EggNOG
Chicken396249CD28CD28 molecule9031CGNC:6581Inparanoid, OMA, EggNOG
Anole lizard100566176cd28CD28 molecule28377Inparanoid, OMA, EggNOG
Xenopus100126210cd28CD28 molecule8364XB-GENE-489232Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.