🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CDK4

DescripciónCyclin-dependent kinase 4

Gene and Protein Information

Gene ID1019
Uniprot Accession IDs P11802 B2R9A0 B4DNF9 O00576 Q6FG61
Ensembl ID ENSP00000257904
Symbol CMM3 PSK-J3
FamilyBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Sequence
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp452025CDK4cyclin dependent kinase 49598VGNC:8366OMA, EggNOG
Macaque715650CDK4cyclin dependent kinase 49544Inparanoid, OMA, EggNOG
Mouse12567Cdk4cyclin-dependent kinase 410090MGI:88357Inparanoid, OMA, EggNOG
Rat94201Cdk4cyclin-dependent kinase 410116RGD:621120Inparanoid, OMA, EggNOG
Dog481131CDK4cyclin dependent kinase 49615VGNC:39054Inparanoid, OMA
Horse100051005CDK4cyclin dependent kinase 49796VGNC:16348Inparanoid, OMA
Cow510618CDK4cyclin dependent kinase 49913Inparanoid, OMA
Pig100144492CDK4cyclin dependent kinase 49823Inparanoid, OMA
Anole lizard100559515cdk4cyclin dependent kinase 428377Inparanoid, OMA
Zebrafish777730cdk4cyclin-dependent kinase 47955ZDB-GENE-060929-974Inparanoid, OMA

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.