224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | CD99 antigen |
|---|
Gene and Protein Information
| Gene ID | 4267 |
|---|---|
| Uniprot Accession IDs | P14209 A6NIW1 O00518 Q6ICV7 |
| Ensembl ID | ENSP00000370588 |
| Symbol | MIC2 MIC2X MIC2Y MIC2 HBA71 MIC2X MIC2Y MSK5X |
| Family | Belongs to the CD99 family. |
| Sequence | MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 751057 | LOC751057 | CD99 antigen | 9598 | OMA, EggNOG | |
| Macaque | 720563 | CD99 | CD99 molecule (Xg blood group) | 9544 | OMA, EggNOG | |
| Rat | 652929 | Cd99 | CD99 molecule (Xg blood group) | 10116 | RGD:1594332 | Inparanoid, OMA |
| Dog | 609832 | CD99 | CD99 molecule | 9615 | VGNC:54127 | Inparanoid, OMA, EggNOG |
| Cow | 509230 | CD99 | CD99 molecule | 9913 | VGNC:50554 | OMA, EggNOG |
| Opossum | 103104378 | CD99 | CD99 molecule (Xg blood group) | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 103171404 | CD99 | CD99 molecule (Xg blood group) | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 418662 | CD99 | CD99 molecule | 9031 | CGNC:17419 | Inparanoid, OMA |
| Xenopus | 100494719 | LOC100494719 | CD99 antigen-like | 8364 | Inparanoid, OMA | |
| Zebrafish | 559896 | cd99 | CD99 molecule | 7955 | ZDB-GENE-061103-391 | Inparanoid, OMA |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.