🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

AGBL4

DescripciónCytosolic carboxypeptidase 6

Gene and Protein Information

Gene ID84871
Uniprot Accession IDs Q5VU57 B3KT26 B4DG37
Ensembl ID ENSP00000360905
Symbol CCP6 CCP6
FamilyBelongs to the peptidase M14 family.
Sequence
MAEGSQSAPEAGNDMGNDDAIGGNVSKYIVLPTGYCGQPKKGHLIFDACFESGNLGRVDQVSEFEYDLFIRPDTCNPRFRVWFNFTVENVKESQRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPKNVYYYRCPDHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEAYMKLGRNVARTFLDYYRLNPVVEKVAIPMPRLRNKEIEVQRRKEKSPPYKHPLLRGPASNYPNSKGDKKSSVNHKDPSTPF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Macaque711073AGBL4ATP/GTP binding protein like 49544Inparanoid, OMA, EggNOG
Mouse78933Agbl4ATP/GTP binding protein-like 410090MGI:1918244Inparanoid, OMA, EggNOG
HorseAGBL4ATP/GTP binding protein like 4 [Source:HGNC Symbol;Acc:HGNC:25892]9796OMA, EggNOG
Opossum100619105AGBL4ATP/GTP binding protein like 413616Inparanoid, OMA, EggNOG
Zebrafish550450agbl4ATP/GTP binding protein-like 47955ZDB-GENE-081104-437Inparanoid, OMA
C. elegans184043ccpp-6Cytosolic carboxypeptidase 66239Inparanoid, OMA, EggNOG
Fruitfly318558CG31019CG31019 gene product from transcript CG31019-RA7227FBgn0051019Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    G-protein    /    Cytosolic carboxypeptidase 6
protein    /    enzyme modulator    /    metalloprotease    /    Cytosolic carboxypeptidase 6
DTO Classes
protein    /    Enzyme    /    Protease    /    Metalloprotease    /    Cytosolic carboxypeptidase 6

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.