GJB7

DescripciónGap junction beta-7 protein

Gene and Protein Information

Gene ID375519
Uniprot Accession IDs Q6PEY0 B3KXL0 Q96KP0
Ensembl ID ENSP00000435355
Symbol CX25 CX25 bA136M9.1 connexin25
FamilyBelongs to the connexin family. Beta-type (group I) subfamily.
Sequence
MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Horse100070584GJB7gap junction protein beta 79796VGNC:51032Inparanoid, OMA
Opossum100025224GJB7gap junction protein beta 713616Inparanoid, OMA
Xenopus100488401gjb7gap junction protein beta 78364XB-GENE-965093Inparanoid, OMA
Zebrafish566668cx28.8connexin 28.87955ZDB-GENE-050616-1Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction beta-7 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction beta-7 protein

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.