🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

GJD3

DescripciónGap junction delta-3 protein

Gene and Protein Information

Gene ID125111
Uniprot Accession IDs Q8N144 Q6ZUW6
Ensembl ID ENSP00000463752
Symbol GJA11 GJC1 GJC1 GJA11 CX31.9 Cx30.2
FamilyBelongs to the connexin family. Delta-type subfamily.
Sequence
MGEWAFLGSLLDAVQLQSPLVGRLWLVVMLIFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLFHILLLSAPPVLFVVYSMHRAGKEAGGAEAAAQCAPGLPEAQCAPCALRARRARRCYLLSVALRLLAELTFLGGQALLYGFRVAPHFACAGPPCPHTVDCFVSRPTEKTVFVLFYFAVGLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPPPALPSRRPGPEPCAPPAYAHPAPASLRECGSGRGKASPATGRRDLAI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp745773GJD3gap junction protein delta 39598VGNC:12222Inparanoid, OMA
Macaque700473GJD3gap junction protein delta 39544Inparanoid, OMA
Mouse353155Gjd3gap junction protein, delta 310090MGI:2384150Inparanoid, OMA
Rat363677Gjd3gap junction protein, delta 310116RGD:1308942Inparanoid, OMA
OpossumGJD3gap junction protein delta 3 [Source:HGNC Symbol;Acc:HGNC:19147]13616Inparanoid, OMA
Anole lizard100567861gjd3gap junction protein delta 328377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    cell junction protein    /    gap junction    /    Gap junction delta-3 protein
DTO Classes
protein    /    Cell-cell junction    /    Gap junction    /    Gap junction delta-3 protein

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.