Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Dynein light chain roadblock-type 1 |
|---|
Gene and Protein Information
| Gene ID | 83658 |
|---|---|
| Uniprot Accession IDs | Q9NP97 B1AKR5 Q5TC72 Q96IV3 Q9NQM2 |
| Ensembl ID | ENSP00000349679 |
| Symbol | BITH DNCL2A DNLC2A ROBLD1 BLP BITH DNCL2A DNLC2A ROBLD1 |
| Family | Belongs to the GAMAD family. |
| Sequence | MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458192 | DYNLRB1 | dynein light chain roadblock-type 1 | 9598 | VGNC:14128 | OMA, EggNOG |
| Macaque | 100428465 | DYNLRB1 | dynein light chain roadblock-type 1 | 9544 | OMA, EggNOG | |
| Mouse | 67068 | Dynlrb1 | dynein light chain roadblock-type 1 | 10090 | MGI:1914318 | Inparanoid, OMA, EggNOG |
| Rat | 170714 | Dynlrb1 | dynein light chain roadblock-type 1 | 10116 | RGD:619910 | Inparanoid, OMA, EggNOG |
| Dog | 477200 | DYNLRB1 | dynein light chain roadblock-type 1 | 9615 | VGNC:40152 | Inparanoid, OMA, EggNOG |
| Horse | 100069352 | DYNLRB1 | dynein light chain roadblock-type 1 | 9796 | VGNC:51533 | OMA, EggNOG |
| Cow | 513342 | DYNLRB1 | dynein light chain roadblock-type 1 | 9913 | VGNC:28276 | Inparanoid, OMA, EggNOG |
| Opossum | 100032367 | DYNLRB1 | dynein light chain roadblock-type 1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100567198 | dynlrb1 | dynein light chain roadblock-type 1 | 28377 | Inparanoid, OMA | |
| Xenopus | 100101695 | dynlrb1 | dynein light chain roadblock-type 1 | 8364 | XB-GENE-489076 | Inparanoid, OMA |
| Zebrafish | 394163 | dynlrb1 | dynein, light chain, roadblock-type 1 | 7955 | ZDB-GENE-040426-989 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain roadblock-type 1
protein / cytoskeletal protein / microtubule family cytoskeletal protein / Dynein light chain roadblock-type 1
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain roadblock-type 1
protein / Cellular structure / Microtubule family cytoskeletal protein / Dynein light chain roadblock-type 1
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.