Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Dehydrogenase/reductase SDR family member 1 |
|---|
Gene and Protein Information
| Gene ID | 115817 |
|---|---|
| Uniprot Accession IDs | Q96LJ7 D3DS71 Q8NDG3 Q96B59 Q96CQ5 |
| Ensembl ID | ENSP00000288111 |
| Symbol | SDR19C1 SDR19C1 |
| Family | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Sequence | MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452816 | DHRS1 | dehydrogenase/reductase 1 | 9598 | VGNC:12779 | OMA, EggNOG |
| Macaque | 715933 | DHRS1 | dehydrogenase/reductase 1 | 9544 | Inparanoid, OMA | |
| Mouse | 52585 | Dhrs1 | dehydrogenase/reductase (SDR family) member 1 | 10090 | MGI:1196314 | Inparanoid, OMA, EggNOG |
| Rat | 290234 | Dhrs1 | dehydrogenase/reductase 1 | 10116 | RGD:1359172 | Inparanoid, OMA, EggNOG |
| Dog | DHRS1 | dehydrogenase/reductase 1 [Source:HGNC Symbol;Acc:HGNC:16445] | 9615 | OMA, EggNOG | ||
| Horse | 100051088 | DHRS1 | dehydrogenase/reductase 1 | 9796 | VGNC:17163 | Inparanoid, OMA, EggNOG |
| Cow | 528832 | DHRS1 | dehydrogenase/reductase 1 | 9913 | VGNC:28039 | Inparanoid, OMA, EggNOG |
| Pig | 100519262 | DHRS1 | dehydrogenase/reductase 1 | 9823 | OMA, EggNOG | |
| Opossum | 100025314 | DHRS1 | dehydrogenase/reductase 1 | 13616 | Inparanoid, EggNOG | |
| Anole lizard | 100555049 | dhrs1 | dehydrogenase/reductase 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 368670 | dhrs1 | dehydrogenase/reductase (SDR family) member 1 | 7955 | ZDB-GENE-030616-591 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.