GNB2

DescripciónGuanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

Gene and Protein Information

Gene ID2783
Uniprot Accession IDs P62879 B3KPU1 P11016 P54312
Ensembl ID ENSP00000305260
FamilyBelongs to the WD repeat G protein beta family.
Sequence
MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp739897GNB2G protein subunit beta 29598VGNC:8684OMA, EggNOG
Mouse14693Gnb2guanine nucleotide binding protein (G protein), beta 210090MGI:95784Inparanoid, OMA
Rat81667Gnb2G protein subunit beta 210116RGD:69319Inparanoid, OMA
Horse100067486GNB2G protein subunit beta 29796VGNC:18425Inparanoid, OMA
Cow281202GNB2G protein subunit beta 29913VGNC:29459Inparanoid, OMA
Opossum100017392GNB2G protein subunit beta 213616Inparanoid, OMA
Zebrafish541370gnb2guanine nucleotide binding protein (G protein), beta polypeptide 27955ZDB-GENE-050320-65Inparanoid, OMA
C. elegans174803gpb-1G Protein, Beta subunit6239Inparanoid, OMA, EggNOG
Fruitfly32544Gbeta13FG protein beta-subunit 13F7227FBgn0001105Inparanoid, EggNOG
S.cerevisiae854387STE4G protein subunit beta4932S000005738OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    heterotrimeric G-protein    /    Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
protein    /    enzyme modulator    /    hydrolase    /    Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.