Alternar navegación 
Buscar
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock
| Descripción | Eukaryotic translation initiation factor 3 subunit J |
|---|
Gene and Protein Information
| Gene ID | 8669 |
|---|---|
| Uniprot Accession IDs | O75822 B4DUI3 F5H425 Q9BUD2 Q9H8Q2 Q9UI65 eIF3j |
| Ensembl ID | ENSP00000261868 |
| Symbol | EIF3S1 EIF3S1 eIF3-p35 eIF3-alpha |
| Family | Belongs to the eIF-3 subunit J family. |
| Sequence | MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 712295 | EIF3J | eukaryotic translation initiation factor 3 subunit J | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 78655 | Eif3j1 | eukaryotic translation initiation factor 3, subunit J1 | 10090 | MGI:1925905 | OMA, EggNOG |
| Mouse | 100042807 | Eif3j2 | eukaryotic translation initiation factor 3, subunit J2 | 10090 | MGI:3704486 | Inparanoid, OMA |
| Rat | 691947 | Eif3j | eukaryotic translation initiation factor 3, subunit J | 10116 | RGD:1593338 | Inparanoid, OMA, EggNOG |
| Dog | 487532 | EIF3J | eukaryotic translation initiation factor 3 subunit J | 9615 | VGNC:40276 | Inparanoid, OMA, EggNOG |
| Horse | 100070638 | EIF3J | eukaryotic translation initiation factor 3 subunit J | 9796 | VGNC:51496 | Inparanoid, OMA, EggNOG |
| Cow | 539052 | EIF3J | eukaryotic translation initiation factor 3 subunit J | 9913 | VGNC:28400 | Inparanoid, OMA, EggNOG |
| Pig | 100517070 | EIF3J | eukaryotic translation initiation factor 3 subunit J | 9823 | OMA, EggNOG | |
| Chicken | 415573 | EIF3J | eukaryotic translation initiation factor 3 subunit J | 9031 | CGNC:6209 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100559362 | eif3j | eukaryotic translation initiation factor 3 subunit J | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 496929 | eif3j | eukaryotic translation initiation factor 3 subunit J | 8364 | XB-GENE-999878 | Inparanoid, OMA, EggNOG |
| Zebrafish | 394189 | eif3ja | eukaryotic translation initiation factor 3, subunit Ja | 7955 | ZDB-GENE-040426-1266 | Inparanoid, OMA, EggNOG |
| Fruitfly | 36037 | Adam | CG12131 gene product from transcript CG12131-RA | 7227 | FBgn0027619 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 3 subunit J
protein / nucleic acid binding / translation initiation factor / Eukaryotic translation initiation factor 3 subunit J
DTO Classes
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 3 subunit J
protein / Nucleic acid binding / RNA binding protein / Translation factor / Translation initiation factor / Eukaryotic translation initiation factor 3 subunit J
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Especificaciones | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Recordármelo más tarde
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.