🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD79A

DescripciónB-cell antigen receptor complex-associated protein alpha chain

Gene and Protein Information

Gene ID973
Uniprot Accession IDs P11912 A0N775 Q53FB8
Ensembl ID ENSP00000221972
Symbol IGA MB1 IGA MB-1
Sequence
MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp740560CD79ACD79a molecule9598VGNC:3643OMA, EggNOG
Mouse12518Cd79aCD79A antigen (immunoglobulin-associated alpha)10090MGI:101774Inparanoid, OMA, EggNOG
Rat100913063Cd79aCD79a molecule10116RGD:6484896OMA, EggNOG
Dog484483CD79ACD79a molecule9615VGNC:38973Inparanoid, OMA, EggNOG
Horse100052219CD79ACD79a molecule9796VGNC:16279Inparanoid, OMA, EggNOG
Cow281674CD79ACD79a molecule9913VGNC:27046Inparanoid, OMA, EggNOG
Anole lizard103282538cd79aCD79a molecule28377Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    defense/immunity protein    /    B-cell antigen receptor complex-associated protein alpha chain
protein    /    receptor    /    cytokine receptor    /    B-cell antigen receptor complex-associated protein alpha chain
DTO Classes
protein    /    Receptor    /    Cytokine receptor    /    Immunoglobulin receptor superfamily    /    B-cell antigen receptor complex-associated protein alpha chain

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.