224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
| Descripción | Granulocyte colony-stimulating factor |
|---|
Gene and Protein Information
| Gene ID | 1440 |
|---|---|
| Uniprot Accession IDs | P09919 A8MXR7 G-CSF |
| Ensembl ID | ENSP00000225474 |
| Symbol | C17orf33 GCSF GCSF CSF3OS C17orf33 |
| Family | Belongs to the IL-6 superfamily. |
| Sequence | MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Nombre | NIF | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 454641 | CSF3 | colony stimulating factor 3 | 9598 | VGNC:9417 | OMA, EggNOG |
| Macaque | 698961 | CSF3 | colony stimulating factor 3 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 12985 | Csf3 | colony stimulating factor 3 (granulocyte) | 10090 | MGI:1339751 | Inparanoid, OMA, EggNOG |
| Rat | 25610 | Csf3 | colony stimulating factor 3 | 10116 | RGD:2426 | Inparanoid, OMA, EggNOG |
| Dog | 608246 | CSF3 | colony stimulating factor 3 | 9615 | VGNC:39657 | Inparanoid, OMA, EggNOG |
| Horse | 100033922 | CSF3 | colony stimulating factor 3 | 9796 | VGNC:16898 | Inparanoid, OMA, EggNOG |
| Cow | 281096 | CSF3 | colony stimulating factor 3 | 9913 | VGNC:27757 | Inparanoid, OMA, EggNOG |
| Pig | 396839 | CSF3 | colony stimulating factor 3 | 9823 | Inparanoid, OMA | |
| Opossum | 100016618 | CSF3 | colony stimulating factor 3 | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 103279240 | LOC103279240 | myelomonocytic growth factor | 28377 | OMA, EggNOG | |
| Xenopus | 100497396 | csf3 | colony stimulating factor 3 | 8364 | XB-GENE-487092 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Nombre | Specification and purity | Expression system | Protein label | Disponibilidad | Mostrar detalles |
|---|
Associated Antibodies
| Nombre | Specifications | Species reactivity | Aplicación | Disponibilidad | Mostrar detalles |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Nombre | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.