CSF3

DescripciónGranulocyte colony-stimulating factor

Gene and Protein Information

Gene ID1440
Uniprot Accession IDs P09919 A8MXR7 G-CSF
Ensembl ID ENSP00000225474
Symbol C17orf33 GCSF GCSF CSF3OS C17orf33
FamilyBelongs to the IL-6 superfamily.
Sequence
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp454641CSF3colony stimulating factor 39598VGNC:9417OMA, EggNOG
Macaque698961CSF3colony stimulating factor 39544Inparanoid, OMA, EggNOG
Mouse12985Csf3colony stimulating factor 3 (granulocyte)10090MGI:1339751Inparanoid, OMA, EggNOG
Rat25610Csf3colony stimulating factor 310116RGD:2426Inparanoid, OMA, EggNOG
Dog608246CSF3colony stimulating factor 39615VGNC:39657Inparanoid, OMA, EggNOG
Horse100033922CSF3colony stimulating factor 39796VGNC:16898Inparanoid, OMA, EggNOG
Cow281096CSF3colony stimulating factor 39913VGNC:27757Inparanoid, OMA, EggNOG
Pig396839CSF3colony stimulating factor 39823Inparanoid, OMA
Opossum100016618CSF3colony stimulating factor 313616Inparanoid, OMA, EggNOG
Anole lizard103279240LOC103279240myelomonocytic growth factor28377OMA, EggNOG
Xenopus100497396csf3colony stimulating factor 38364XB-GENE-487092Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.