🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD3D

DescripciónT-cell surface glycoprotein CD3 delta chain

Gene and Protein Information

Gene ID915
Uniprot Accession IDs P04234 A8MVP6
Ensembl ID ENSP00000300692
Symbol T3D T3D IMD19 CD3-DELTA
Sequence
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp451584CD3DCD3d molecule9598VGNC:6481OMA, EggNOG
Macaque699582CD3DCD3d molecule9544Inparanoid, EggNOG
Mouse12500Cd3dCD3 antigen, delta polypeptide10090MGI:88331Inparanoid, OMA, EggNOG
Rat25710Cd3dCD3d molecule10116RGD:2304Inparanoid, OMA, EggNOG
Dog479419CD3DCD3d molecule9615VGNC:38954Inparanoid, OMA, EggNOG
Horse100062931CD3DCD3d molecule9796VGNC:16263Inparanoid, OMA, EggNOG
Cow281053CD3DCD3d molecule9913VGNC:27028Inparanoid, OMA, EggNOG
Pig396661CD3DCD3d molecule9823Inparanoid, OMA, EggNOG
Opossum100031472CD3DCD3d molecule13616Inparanoid, OMA, EggNOG
Chicken396518CD3DCD3d molecule9031CGNC:49849OMA, EggNOG
Xenopus100216101cd3gCD3g molecule8364XB-GENE-480422OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.