🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD3E

DescripciónT-cell surface glycoprotein CD3 epsilon chain

Gene and Protein Information

Gene ID916
Uniprot Accession IDs P07766 A8K997
Ensembl ID ENSP00000354566
Symbol T3E T3E TCRE IMD18
Sequence
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp742330CD3ECD3e molecule9598VGNC:6482OMA, EggNOG
Macaque699467CD3ECD3e molecule9544Inparanoid, OMA, EggNOG
Mouse12501Cd3eCD3 antigen, epsilon polypeptide10090MGI:88332Inparanoid, OMA, EggNOG
Rat315609Cd3eCD3e molecule10116RGD:1309222Inparanoid, OMA, EggNOG
Dog442981CD3ECD3e molecule9615VGNC:38955Inparanoid, OMA, EggNOG
Horse100629532CD3ECD3e molecule9796VGNC:16264Inparanoid, OMA, EggNOG
Cow281054CD3ECD3e molecule9913VGNC:27029Inparanoid, OMA, EggNOG
Pig397455CD3ECD3e molecule9823Inparanoid, EggNOG
Opossum100031478CD3ECD3e molecule13616Inparanoid, OMA, EggNOG
Chicken396062CD3ECD3e molecule9031CGNC:5597Inparanoid, OMA, EggNOG
Xenopus100101735cd3eCD3e molecule8364XB-GENE-919749Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.