🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD8B

DescripciónT-cell surface glycoprotein CD8 beta chain

Gene and Protein Information

Gene ID926
Uniprot Accession IDs P10966 P14860 P14861 Q15980 Q496E0 Q496E1 Q496E2 Q9UDB4 Q9UDB5 Q9UDB6 Q9UDB7 Q9UDB8 Q9UDB9 Q9UDC0 Q9UQ55
Ensembl ID ENSP00000331172
Symbol CD8B1 LY3 P37 LEU2 LYT3 CD8B1
Sequence
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQFYK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp470426CD8BCD8b molecule9598VGNC:10544OMA, EggNOG
Macaque699409CD8BCD8b molecule9544OMA, EggNOG
Mouse12526Cd8b1CD8 antigen, beta chain 110090MGI:88347OMA, EggNOG
Rat24931Cd8bCD8b molecule10116RGD:2317OMA, EggNOG
Dog483076CD8BCD8b molecule9615OMA, EggNOG
Horse100052855CD8BCD8b molecule9796OMA, EggNOG
Cow508633CD8BCD8b molecule9913OMA, EggNOG
Pig396636CD8BCD8b molecule9823OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.