224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Cyclin-dependent kinase inhibitor 1B |
|---|
Gene and Protein Information
| Gene ID | 1027 |
|---|---|
| Uniprot Accession IDs | P46527 Q16307 Q5U0H2 Q9BUS6 |
| Ensembl ID | ENSP00000228872 |
| Symbol | KIP1 KIP1 MEN4 CDKN4 MEN1B P27KIP1 |
| Family | Belongs to the CDI family. |
| Sequence | MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 466947 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9598 | VGNC:8367 | OMA, EggNOG |
| Macaque | 697188 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9544 | Inparanoid, EggNOG | |
| Mouse | 12576 | Cdkn1b | cyclin-dependent kinase inhibitor 1B | 10090 | MGI:104565 | Inparanoid, OMA, EggNOG |
| Rat | 83571 | Cdkn1b | cyclin-dependent kinase inhibitor 1B | 10116 | RGD:69062 | Inparanoid, OMA, EggNOG |
| Dog | 403429 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9615 | VGNC:39069 | Inparanoid, OMA, EggNOG |
| Cow | 512613 | CDKN1B | cyclin dependent kinase inhibitor 1B | 9913 | VGNC:27143 | Inparanoid, OMA, EggNOG |
| Opossum | 100014923 | CDKN1B | cyclin dependent kinase inhibitor 1B | 13616 | Inparanoid, OMA, EggNOG | |
| Anole lizard | 100565071 | cdkn1b | cyclin dependent kinase inhibitor 1B | 28377 | Inparanoid, OMA | |
| C. elegans | 174261 | cki-2 | CKI family (Cyclin-dependent Kinase Inhibitor) | 6239 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.