CD59

DescripciónCD59 glycoprotein

Gene and Protein Information

Gene ID966
Uniprot Accession IDs P13987
Ensembl ID ENSP00000379191
Symbol MIC11 MIN1 MIN2 MIN3 MSK21 1F5 EJ16 EJ30 EL32 G344 MIN1 MIN2 MIN3 MIRL HRF20 MACIF MEM43 MIC11 MSK21 16.3A5 HRF-20 MAC-IP p18-20
Sequence
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp739046CD59CD59 molecule (CD59 blood group)9598VGNC:11287OMA, EggNOG
Mouse333883Cd59bCD59b antigen10090MGI:1888996OMA, EggNOG
Mouse12509Cd59aCD59a antigen10090MGI:109177Inparanoid, OMA
Rat25407Cd59CD59 molecule10116RGD:2311Inparanoid, OMA, EggNOG
Dog475945CD59CD59 molecule (CD59 blood group)9615Inparanoid, OMA, EggNOG
Cow505574CD59CD59 molecule (CD59 blood group)9913Inparanoid, OMA, EggNOG
Pig397347CD59CD59 molecule (CD59 blood group)9823Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.