🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CD82

DescripciónCD82 antigen

Gene and Protein Information

Gene ID3732
Uniprot Accession IDs P27701 D3DQN6 E9PC70 Q7Z2D4 Q7Z5N2
Ensembl ID ENSP00000227155
Symbol KAI1 SAR2 ST6 TSPAN27 R2 4F9 C33 IA4 ST6 GR15 KAI1 SAR2 TSPAN27
FamilyBelongs to the tetraspanin (TM4SF) family.
Sequence
MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp741685CD82CD82 molecule9598VGNC:11290OMA, EggNOG
Macaque715606CD82CD82 molecule9544Inparanoid, OMA, EggNOG
Mouse12521Cd82CD82 antigen10090MGI:104651Inparanoid, OMA, EggNOG
Rat83628Cd82Cd82 molecule10116RGD:69070Inparanoid, OMA, EggNOG
Dog611384CD82CD82 molecule9615VGNC:38976Inparanoid, OMA, EggNOG
Horse100056000CD82CD82 molecule9796VGNC:16280Inparanoid, OMA, EggNOG
Cow506713CD82CD82 molecule9913VGNC:27049Inparanoid, OMA, EggNOG
Pig100270689CD82CD82 molecule9823Inparanoid, OMA, EggNOG
Opossum100011022CD82CD82 molecule13616Inparanoid, OMA, EggNOG
Platypus100075099CD82CD82 molecule9258Inparanoid, OMA, EggNOG
Anole lizard100555967cd82CD82 molecule28377Inparanoid, OMA, EggNOG
Xenopus394799cd82CD82 molecule8364XB-GENE-945242Inparanoid, OMA, EggNOG
Zebrafish324098cd82aCD82 molecule a7955ZDB-GENE-030131-2818Inparanoid, OMA
Zebrafish324137cd82bCD82 molecule b7955ZDB-GENE-030131-2857OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.