🌎 Ship to: United States
Toggle Nav
Cart
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS CoA
Menú
Cuenta
Configuración
྾
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items

CD83

DescripciónCD83 antigen

Gene and Protein Information

Gene ID9308
Uniprot Accession IDs Q01151 Q5THX9 hCD83
Ensembl ID ENSP00000368450
Symbol BL11 HB15
Sequence
MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp462446CD83CD83 molecule9598VGNC:11041OMA, EggNOG
Macaque701825CD83CD83 molecule9544Inparanoid, OMA, EggNOG
Mouse12522Cd83CD83 antigen10090MGI:1328316Inparanoid, OMA, EggNOG
Rat361226Cd83CD83 molecule10116RGD:1309677Inparanoid, OMA, EggNOG
Dog610141CD83CD83 molecule9615VGNC:38977Inparanoid, OMA, EggNOG
HorseCD83CD83 molecule [Source:HGNC Symbol;Acc:HGNC:1703]9796OMA, EggNOG
Cow617034CD83CD83 molecule9913VGNC:27050Inparanoid, OMA, EggNOG
Pig100153365CD83CD83 molecule9823OMA, EggNOG
Opossum100026047CD83CD83 molecule13616Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreSpecificationsSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.