🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CYP46A1

DescripciónCholesterol 24-hydroxylase

Gene and Protein Information

Gene ID10858
Uniprot Accession IDs Q9Y6A2 B4DHP8 E7EQG9 Q8N2B0 CH24H
Ensembl ID ENSP00000261835
Symbol CYP46 CP46 CYP46
FamilyBelongs to the cytochrome P450 family.
Sequence
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp453154CYP46A1cytochrome P450 family 46 subfamily A member 19598VGNC:7521OMA, EggNOG
Macaque705843LOC705843cholesterol 24-hydroxylase9544OMA, EggNOG
Mouse13116Cyp46a1cytochrome P450, family 46, subfamily a, polypeptide 110090MGI:1341877Inparanoid, OMA, EggNOG
Rat362782Cyp46a1cytochrome P450, family 46, subfamily a, polypeptide 110116RGD:1306605Inparanoid, OMA
Dog480432CYP46A1cytochrome P450 family 46 subfamily A member 19615VGNC:50360Inparanoid, OMA, EggNOG
Horse100051131LOC100051131cholesterol 24-hydroxylase9796OMA, EggNOG
CowCYP46A1cytochrome P450 family 46 subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:2641]9913OMA, EggNOG
Pig100512793LOC100512793cholesterol 24-hydroxylase9823Inparanoid, OMA, EggNOG
Chicken423450CYP46A1cytochrome P450 family 46 subfamily A member 19031CGNC:8476Inparanoid, OMA, EggNOG
Anole lizard100552607LOC100552607cholesterol 24-hydroxylase28377OMA, EggNOG
Anole lizard100552409LOC100552409cholesterol 24-hydroxylase28377Inparanoid, OMA
Xenopus613109mgc108213uncharacterized protein mgc1082138364XB-GENE-969052OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    oxygenase    /    Cholesterol 24-hydroxylase
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Oxygenase    /    Cholesterol 24-hydroxylase

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.